Lineage for d3muy13 (3muy 1:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832572Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2832605Domain d3muy13: 3muy 1:334-625 [247760]
    Other proteins in same PDB: d3muy11, d3muy12, d3muy14, d3muy15, d3muy21, d3muy22, d3muy24, d3muy25, d3muy31, d3muy32, d3muy34, d3muy35, d3muy41, d3muy42, d3muy44, d3muy45
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3muy13

PDB Entry: 3muy (more details), 2.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (r599a)
PDB Compounds: (1:) Beta-D-galactosidase

SCOPe Domain Sequences for d3muy13:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muy13 c.1.8.0 (1:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndaqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3muy13:

Click to download the PDB-style file with coordinates for d3muy13.
(The format of our PDB-style files is described here.)

Timeline for d3muy13: