Lineage for d1qlca_ (1qlc A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily) Superfamily b.36.1: PDZ domain-like [50156] (2 families) 
Family b.36.1.1: PDZ domain [50157] (7 proteins) 
Protein Synaptic protein PSD-95 [50162] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (3 PDB entries) 
Domain d1qlca_: 1qlc A: [24776]
Details for d1qlca_
PDB Entry: 1qlc (more details)
PDB Description: solution structure of the second pdz domain of postsynaptic density-95
SCOP Domain Sequences for d1qlca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlca_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus)}
aekvmeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgrlqigdkila
vnsvgledvmhedavaalkntydvvylkvakpsna
SCOP Domain Coordinates for d1qlca_:
Click to download the PDB-style file with coordinates for d1qlca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlca_:
- d1qlca_ appears in SCOP 1.57
- d1qlca_ appears in the current release, SCOPe 2.08
View in 3D