Lineage for d1qlca_ (1qlc A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13490Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 13491Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 13492Family b.36.1.1: PDZ domain [50157] (7 proteins)
  6. 13514Protein Synaptic protein PSD-95 [50162] (1 species)
  7. 13515Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (3 PDB entries)
  8. 13518Domain d1qlca_: 1qlc A: [24776]

Details for d1qlca_

PDB Entry: 1qlc (more details)

PDB Description: solution structure of the second pdz domain of postsynaptic density-95

SCOP Domain Sequences for d1qlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlca_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus)}
aekvmeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgrlqigdkila
vnsvgledvmhedavaalkntydvvylkvakpsna

SCOP Domain Coordinates for d1qlca_:

Click to download the PDB-style file with coordinates for d1qlca_.
(The format of our PDB-style files is described here.)

Timeline for d1qlca_: