Lineage for d1qlca_ (1qlc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786128Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2786157Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (14 PDB entries)
    Uniprot P31016 62-154
  8. 2786172Domain d1qlca_: 1qlc A: [24776]
    second PDZ domain

Details for d1qlca_

PDB Entry: 1qlc (more details)

PDB Description: solution structure of the second pdz domain of postsynaptic density-95
PDB Compounds: (A:) postsynaptic density protein 95

SCOPe Domain Sequences for d1qlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlca_ b.36.1.1 (A:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aekvmeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgrlqigdkila
vnsvgledvmhedavaalkntydvvylkvakpsna

SCOPe Domain Coordinates for d1qlca_:

Click to download the PDB-style file with coordinates for d1qlca_.
(The format of our PDB-style files is described here.)

Timeline for d1qlca_: