Lineage for d3muna2 (3mun A:418-690)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509435Species Aeromonas punctata [TaxId:648] [232631] (8 PDB entries)
  8. 2509437Domain d3muna2: 3mun A:418-690 [247755]
    Other proteins in same PDB: d3muna1
    automated match to d3iula2
    complexed with gol, so4, suc

Details for d3muna2

PDB Entry: 3mun (more details), 2.1 Å

PDB Description: appep_pepclose closed state
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3muna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muna2 c.69.1.0 (A:418-690) automated matches {Aeromonas punctata [TaxId: 648]}
edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl
dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg
snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk
gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnagh
gagtpvaklieqsadiyaftlyemgyrelprqp

SCOPe Domain Coordinates for d3muna2:

Click to download the PDB-style file with coordinates for d3muna2.
(The format of our PDB-style files is described here.)

Timeline for d3muna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3muna1