SCOPe 2.04: Domain d3muna1: 3mun A:7-417

Lineage for d3muna1 (3mun A:7-417)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families)

5. Family b.69.7.0: automated matches [227149] (1 protein)
   not a true family

6. Protein automated matches [226853] (3 species)
   not a true protein

7. Species Aeromonas punctata [TaxId:648] [232629] (8 PDB entries)

8. Domain d3muna1: 3mun A:7-417 [247754]
   Other proteins in same PDB: d3muna2
   automated match to d3iula1
   complexed with gol, so4, suc

Details for d3muna1

PDB Entry: 3mun, 2.1 Å

PDB Description: appep_pepclose closed state

PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3muna1:

Sequence; same for both SEQRES and ATOM records:

>d3muna1 b.69.7.0 (A:7-417) automated matches {Aeromonas punctata [TaxId: 648]}
lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
eklaaswnyakegapfwwgryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
yssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvtedqrfll
isaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvt
vdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpg
lgsvsgfngywwdpalyfgfenyaqpptlyrfepksgaislyrasaapfkp

Timeline for d3muna1:

• d3muna1 is new in SCOPe 2.04-stable
  
• d3muna1 appears in SCOPe 2.05
  
• d3muna1 appears in the current release, SCOPe 2.08