| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Francisella tularensis [TaxId:177416] [232833] (3 PDB entries) |
| Domain d3msza1: 3msz A:93-85 [247750] Other proteins in same PDB: d3msza2, d3mszb2 automated match to d3lgca_ complexed with cac, gol, gsh |
PDB Entry: 3msz (more details), 2.05 Å
SCOPe Domain Sequences for d3msza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3msza1 c.47.1.0 (A:93-85) automated matches {Francisella tularensis [TaxId: 177416]}
mkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpistvp
qifiddehiggftelkanadkilnk
Timeline for d3msza1: