Lineage for d3msyc1 (3msy C:28-147)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649513Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries)
  8. 1649528Domain d3msyc1: 3msy C:28-147 [247742]
    Other proteins in same PDB: d3msya2, d3msyb2, d3msyc2, d3msyd2, d3msye2, d3msyf2
    automated match to d3bjsa1

Details for d3msyc1

PDB Entry: 3msy (more details), 2.5 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3msyc1:

Sequence, based on SEQRES records: (download)

>d3msyc1 d.54.1.0 (C:28-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidriiheelap
tligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

Sequence, based on observed residues (ATOM records): (download)

>d3msyc1 d.54.1.0 (C:28-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ipmvaplarefrgshthrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

SCOPe Domain Coordinates for d3msyc1:

Click to download the PDB-style file with coordinates for d3msyc1.
(The format of our PDB-style files is described here.)

Timeline for d3msyc1: