| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries) |
| Domain d3msyc1: 3msy C:28-147 [247742] Other proteins in same PDB: d3msya2, d3msyb2, d3msyc2, d3msyd2, d3msye2, d3msyf2 automated match to d3bjsa1 |
PDB Entry: 3msy (more details), 2.5 Å
SCOPe Domain Sequences for d3msyc1:
Sequence, based on SEQRES records: (download)
>d3msyc1 d.54.1.0 (C:28-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidriiheelap
tligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg
>d3msyc1 d.54.1.0 (C:28-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ipmvaplarefrgshthrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg
Timeline for d3msyc1: