Lineage for d1be9a_ (1be9 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13490Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 13491Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 13492Family b.36.1.1: PDZ domain [50157] (7 proteins)
  6. 13514Protein Synaptic protein PSD-95 [50162] (1 species)
  7. 13515Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (3 PDB entries)
  8. 13516Domain d1be9a_: 1be9 A: [24774]

Details for d1be9a_

PDB Entry: 1be9 (more details), 1.82 Å

PDB Description: the third pdz domain from the synaptic protein psd-95 in complex with a c-terminal peptide derived from cript.

SCOP Domain Sequences for d1be9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be9a_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus)}
flgeedipreprrivihrgstglgfniiggedgegifisfilaggpadlsgelrkgdqil
svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvnssgrivtn

SCOP Domain Coordinates for d1be9a_:

Click to download the PDB-style file with coordinates for d1be9a_.
(The format of our PDB-style files is described here.)

Timeline for d1be9a_: