SCOPe 2.04: Domain d3mlka2: 3mlk A:199-354

Lineage for d3mlka2 (3mlk A:199-354)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)

6. Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (17 PDB entries)

8. Domain d3mlka2: 3mlk A:199-354 [247736]
   automated match to d1phma2
   complexed with cu, ni, no2

Details for d3mlka2

PDB Entry: 3mlk, 3.1 Å

PDB Description: Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound nitrite

PDB Compounds: (A:) Peptidyl-glycine alpha-amidating monooxygenase

SCOPe Domain Sequences for d3mlka2:

Sequence; same for both SEQRES and ATOM records:

>d3mlka2 b.121.1.2 (A:199-354) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipi

Timeline for d3mlka2:

• d3mlka2 is new in SCOPe 2.04-stable
  
• d3mlka2 appears in SCOPe 2.05
  
• d3mlka2 appears in the current release, SCOPe 2.08