Lineage for d3mjyb1 (3mjy B:1-312)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080433Species Leishmania major [TaxId:5664] [255853] (6 PDB entries)
  8. 2080441Domain d3mjyb1: 3mjy B:1-312 [247734]
    Other proteins in same PDB: d3mjya2, d3mjyb2
    automated match to d3c61a_
    complexed with fmn, gol, ijz, so4

Details for d3mjyb1

PDB Entry: 3mjy (more details), 1.96 Å

PDB Description: Crystal structure of dihydroorotate dehydrogenase from Leishmania major in complex with 5-Aminoorotic acid
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d3mjyb1:

Sequence, based on SEQRES records: (download)

>d3mjyb1 c.1.4.1 (B:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaae
ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr
cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq
tldefrgkvrtl

Sequence, based on observed residues (ATOM records): (download)

>d3mjyb1 c.1.4.1 (B:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlsqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkv
qfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrrcpgklifg
cggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryqtldefrgk
vrtl

SCOPe Domain Coordinates for d3mjyb1:

Click to download the PDB-style file with coordinates for d3mjyb1.
(The format of our PDB-style files is described here.)

Timeline for d3mjyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mjyb2