Lineage for d3mjgb_ (3mjg B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033578Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 3033655Protein automated matches [190290] (1 species)
    not a true protein
  7. 3033656Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)
  8. 3033663Domain d3mjgb_: 3mjg B: [247728]
    automated match to d1pdga_
    complexed with nag, ndg

Details for d3mjgb_

PDB Entry: 3mjg (more details), 2.3 Å

PDB Description: the structure of a platelet derived growth factor receptor complex
PDB Compounds: (B:) Platelet-derived growth factor subunit B

SCOPe Domain Sequences for d3mjgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjgb_ g.17.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgsltiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcr
ptqvqlrpvqvrkieivrkkpifkkatvtledhlackcetv

SCOPe Domain Coordinates for d3mjgb_:

Click to download the PDB-style file with coordinates for d3mjgb_.
(The format of our PDB-style files is described here.)

Timeline for d3mjgb_: