Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein automated matches [190290] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries) |
Domain d3mjgb_: 3mjg B: [247728] automated match to d1pdga_ complexed with nag, ndg |
PDB Entry: 3mjg (more details), 2.3 Å
SCOPe Domain Sequences for d3mjgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjgb_ g.17.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgsltiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcr ptqvqlrpvqvrkieivrkkpifkkatvtledhlackcetv
Timeline for d3mjgb_: