Lineage for d3mjga_ (3mjg A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260465Protein automated matches [190290] (1 species)
    not a true protein
  7. 2260466Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)
  8. 2260471Domain d3mjga_: 3mjg A: [247727]
    automated match to d1pdga_
    complexed with nag, ndg

Details for d3mjga_

PDB Entry: 3mjg (more details), 2.3 Å

PDB Description: the structure of a platelet derived growth factor receptor complex
PDB Compounds: (A:) Platelet-derived growth factor subunit B

SCOPe Domain Sequences for d3mjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjga_ g.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcrptqv
qlrpvqvrkieivrkkpifkkatvtledhlackcetv

SCOPe Domain Coordinates for d3mjga_:

Click to download the PDB-style file with coordinates for d3mjga_.
(The format of our PDB-style files is described here.)

Timeline for d3mjga_: