| Class g: Small proteins [56992] (94 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
| Protein automated matches [190290] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries) |
| Domain d3mjga_: 3mjg A: [247727] automated match to d1pdga_ complexed with nag, ndg |
PDB Entry: 3mjg (more details), 2.3 Å
SCOPe Domain Sequences for d3mjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjga_ g.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcrptqv
qlrpvqvrkieivrkkpifkkatvtledhlackcetv
Timeline for d3mjga_: