SCOPe 2.07: Domain d3mjfa3: 3mjf A:328-428

Lineage for d3mjfa3 (3mjf A:328-428)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (16 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [255971] (1 PDB entry)

8. Domain d3mjfa3: 3mjf A:328-428 [247726]
   Other proteins in same PDB: d3mjfa1, d3mjfa2, d3mjfa4
   automated match to d1gsoa1
   complexed with bme, edo, gol, na, peg, pge, so4

Details for d3mjfa3

PDB Entry: 3mjf, 1.47 Å

PDB Description: phosphoribosylamine-glycine ligase from yersinia pestis

PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d3mjfa3:

Sequence; same for both SEQRES and ATOM records:

>d3mjfa3 b.84.2.0 (A:328-428) automated matches {Yersinia pestis [TaxId: 214092]}
erpslgvvlaaggypadyrqgdvihglpqqevkdgkvfhagtklngnhevvtnggrvlcv
talgetvaqaqqyayqlaegiqwegvfcrkdigyraiargk

Timeline for d3mjfa3:

• d3mjfa3 first appeared in SCOPe 2.04
  
• d3mjfa3 appears in SCOPe 2.06
  
• d3mjfa3 appears in the current release, SCOPe 2.08