Lineage for d3mjfa3 (3mjf A:328-428)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082834Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2082959Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2082960Protein automated matches [254496] (13 species)
    not a true protein
  7. 2083011Species Yersinia pestis [TaxId:214092] [255971] (1 PDB entry)
  8. 2083012Domain d3mjfa3: 3mjf A:328-428 [247726]
    Other proteins in same PDB: d3mjfa1, d3mjfa2, d3mjfa4
    automated match to d1gsoa1
    complexed with bme, edo, gol, na, peg, pge, so4

Details for d3mjfa3

PDB Entry: 3mjf (more details), 1.47 Å

PDB Description: phosphoribosylamine-glycine ligase from yersinia pestis
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d3mjfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjfa3 b.84.2.0 (A:328-428) automated matches {Yersinia pestis [TaxId: 214092]}
erpslgvvlaaggypadyrqgdvihglpqqevkdgkvfhagtklngnhevvtnggrvlcv
talgetvaqaqqyayqlaegiqwegvfcrkdigyraiargk

SCOPe Domain Coordinates for d3mjfa3:

Click to download the PDB-style file with coordinates for d3mjfa3.
(The format of our PDB-style files is described here.)

Timeline for d3mjfa3: