![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (39 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [226276] (2 PDB entries) |
![]() | Domain d3mjfa1: 3mjf A:1-103 [247724] Other proteins in same PDB: d3mjfa2, d3mjfa3, d3mjfa4 automated match to d1gsoa2 complexed with bme, edo, gol, na, peg, pge, so4 |
PDB Entry: 3mjf (more details), 1.47 Å
SCOPe Domain Sequences for d3mjfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjfa1 c.30.1.0 (A:1-103) automated matches {Yersinia pestis [TaxId: 214092]} mniliignggrehalgwkaaqspladkiyvapgnagtaleptlenvdiaatdiagllafa qshdigltivgpeaplvigvvdafraaglaifgptqaaaqleg
Timeline for d3mjfa1: