Lineage for d3mjfa1 (3mjf A:1-103)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470809Species Yersinia pestis [TaxId:214092] [226276] (2 PDB entries)
  8. 2470810Domain d3mjfa1: 3mjf A:1-103 [247724]
    Other proteins in same PDB: d3mjfa2, d3mjfa3, d3mjfa4
    automated match to d1gsoa2
    complexed with bme, edo, gol, na, peg, pge, so4

Details for d3mjfa1

PDB Entry: 3mjf (more details), 1.47 Å

PDB Description: phosphoribosylamine-glycine ligase from yersinia pestis
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d3mjfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjfa1 c.30.1.0 (A:1-103) automated matches {Yersinia pestis [TaxId: 214092]}
mniliignggrehalgwkaaqspladkiyvapgnagtaleptlenvdiaatdiagllafa
qshdigltivgpeaplvigvvdafraaglaifgptqaaaqleg

SCOPe Domain Coordinates for d3mjfa1:

Click to download the PDB-style file with coordinates for d3mjfa1.
(The format of our PDB-style files is described here.)

Timeline for d3mjfa1: