SCOPe 2.05: Domain d3mjfa1: 3mjf A:0-103

Lineage for d3mjfa1 (3mjf A:0-103)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (28 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [226276] (2 PDB entries)

8. Domain d3mjfa1: 3mjf A:0-103 [247724]
   Other proteins in same PDB: d3mjfa2, d3mjfa3
   automated match to d1gsoa2
   complexed with bme, edo, gol, na, peg, pge, so4

Details for d3mjfa1

PDB Entry: 3mjf, 1.47 Å

PDB Description: phosphoribosylamine-glycine ligase from yersinia pestis

PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d3mjfa1:

Sequence; same for both SEQRES and ATOM records:

>d3mjfa1 c.30.1.0 (A:0-103) automated matches {Yersinia pestis [TaxId: 214092]}
amniliignggrehalgwkaaqspladkiyvapgnagtaleptlenvdiaatdiagllaf
aqshdigltivgpeaplvigvvdafraaglaifgptqaaaqleg

Timeline for d3mjfa1:

• d3mjfa1 first appeared in SCOPe 2.04
  
• d3mjfa1 appears in SCOPe 2.06
  
• d3mjfa1 appears in the current release, SCOPe 2.08