![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) ![]() not a true superfamily |
![]() | Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
![]() | Protein automated matches [254616] (4 species) not a true protein |
![]() | Species Human rotavirus g4 [TaxId:10960] [255969] (1 PDB entry) |
![]() | Domain d3miwd_: 3miw D: [247717] automated match to d1g1ja_ complexed with edo |
PDB Entry: 3miw (more details), 2.5 Å
SCOPe Domain Sequences for d3miwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3miwd_ h.1.13.1 (D:) automated matches {Human rotavirus g4 [TaxId: 10960]} mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrp
Timeline for d3miwd_: