Lineage for d1pdra_ (1pdr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395511Protein Discs large protein homolog [50158] (1 species)
  7. 2395512Species Human (Homo sapiens) [TaxId:9606] [50159] (2 PDB entries)
  8. 2395516Domain d1pdra_: 1pdr A: [24771]
    third PDZ domain

Details for d1pdra_

PDB Entry: 1pdr (more details), 2.8 Å

PDB Description: crystal structure of the third pdz domain from the human homolog of discs large protein
PDB Compounds: (A:) human discs large protein

SCOPe Domain Sequences for d1pdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdra_ b.36.1.1 (A:) Discs large protein homolog {Human (Homo sapiens) [TaxId: 9606]}
itreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvnsvd
lraasheqaaaalknagqavtivaqyrpeeysrqha

SCOPe Domain Coordinates for d1pdra_:

Click to download the PDB-style file with coordinates for d1pdra_.
(The format of our PDB-style files is described here.)

Timeline for d1pdra_: