Lineage for d1pdra_ (1pdr A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666603Protein Discs large protein homolog [50158] (1 species)
  7. 666604Species Human (Homo sapiens) [TaxId:9606] [50159] (2 PDB entries)
  8. 666605Domain d1pdra_: 1pdr A: [24771]
    third PDZ domain

Details for d1pdra_

PDB Entry: 1pdr (more details), 2.8 Å

PDB Description: crystal structure of the third pdz domain from the human homolog of discs large protein
PDB Compounds: (A:) human discs large protein

SCOP Domain Sequences for d1pdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdra_ b.36.1.1 (A:) Discs large protein homolog {Human (Homo sapiens) [TaxId: 9606]}
itreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvnsvd
lraasheqaaaalknagqavtivaqyrpeeysrqha

SCOP Domain Coordinates for d1pdra_:

Click to download the PDB-style file with coordinates for d1pdra_.
(The format of our PDB-style files is described here.)

Timeline for d1pdra_: