Lineage for d1pdr__ (1pdr -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462260Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 462261Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 462262Family b.36.1.1: PDZ domain [50157] (29 proteins)
    Pfam 00595
  6. 462273Protein Discs large protein homolog [50158] (1 species)
  7. 462274Species Human (Homo sapiens) [TaxId:9606] [50159] (1 PDB entry)
  8. 462275Domain d1pdr__: 1pdr - [24771]
    third PDZ domain

Details for d1pdr__

PDB Entry: 1pdr (more details), 2.8 Å

PDB Description: crystal structure of the third pdz domain from the human homolog of discs large protein

SCOP Domain Sequences for d1pdr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdr__ b.36.1.1 (-) Discs large protein homolog {Human (Homo sapiens)}
itreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvnsvd
lraasheqaaaalknagqavtivaqyrpeeysrqha

SCOP Domain Coordinates for d1pdr__:

Click to download the PDB-style file with coordinates for d1pdr__.
(The format of our PDB-style files is described here.)

Timeline for d1pdr__: