Lineage for d1pdr__ (1pdr -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily) Superfamily b.36.1: PDZ domain-like [50156] (2 families) 
Family b.36.1.1: PDZ domain [50157] (9 proteins) 
Protein Discs large protein homolog [50158] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50159] (1 PDB entry) 
Domain d1pdr__: 1pdr - [24771]
Details for d1pdr__
PDB Entry: 1pdr (more details), 2.8 Å
PDB Description: crystal structure of the third pdz domain from the human homolog of discs large protein
SCOP Domain Sequences for d1pdr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdr__ b.36.1.1 (-) Discs large protein homolog {Human (Homo sapiens)}
itreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvnsvd
lraasheqaaaalknagqavtivaqyrpeeysrqha
SCOP Domain Coordinates for d1pdr__:
Click to download the PDB-style file with coordinates for d1pdr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pdr__:
- d1pdr__ first appeared (with stable ids) in SCOP 1.55
- d1pdr__ appears in SCOP 1.59
- d1pdr__ appears in the current release, SCOPe 2.08, called d1pdra_
View in 3D