SCOPe 2.05: Domain d3mh4a2: 3mh4 A:260-353

Lineage for d3mh4a2 (3mh4 A:260-353)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
   duplication: tandem repeat of two PDZ domains

7. Species Escherichia coli [TaxId:562] [74935] (4 PDB entries)

8. Domain d3mh4a2: 3mh4 A:260-353 [247706]
   Other proteins in same PDB: d3mh4a1
   automated match to d1ky9a1

Details for d3mh4a2

PDB Entry: 3mh4, 3.1 Å

PDB Description: htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues

PDB Compounds: (A:) Protease do

SCOPe Domain Sequences for d3mh4a2:

Sequence; same for both SEQRES and ATOM records:

>d3mh4a2 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnle

Timeline for d3mh4a2:

• d3mh4a2 first appeared in SCOPe 2.04
  
• d3mh4a2 appears in SCOPe 2.06
  
• d3mh4a2 appears in the current release, SCOPe 2.08