Lineage for d3mgia1 (3mgi A:252-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716126Domain d3mgia1: 3mgi A:252-328 [247700]
    Other proteins in same PDB: d3mgia2, d3mgia3
    automated match to d1rzta1
    protein/DNA complex; complexed with d3t, mg, na; mutant

Details for d3mgia1

PDB Entry: 3mgi (more details), 2.6 Å

PDB Description: ternary complex of a dna polymerase lambda loop mutant
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3mgia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgia1 a.60.6.1 (A:252-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldhi

SCOPe Domain Coordinates for d3mgia1:

Click to download the PDB-style file with coordinates for d3mgia1.
(The format of our PDB-style files is described here.)

Timeline for d3mgia1: