Lineage for d3mghc2 (3mgh C:329-385)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001966Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001967Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2002145Protein DNA polymerase lambda [101253] (1 species)
  7. 2002146Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2002180Domain d3mghc2: 3mgh C:329-385 [247698]
    Other proteins in same PDB: d3mgha1, d3mgha3, d3mghc1, d3mghc3
    automated match to d1xsna2
    protein/DNA complex; complexed with na; mutant

Details for d3mghc2

PDB Entry: 3mgh (more details), 2.4 Å

PDB Description: binary complex of a dna polymerase lambda loop mutant
PDB Compounds: (C:) DNA polymerase lambda

SCOPe Domain Sequences for d3mghc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mghc2 a.60.12.1 (C:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d3mghc2:

Click to download the PDB-style file with coordinates for d3mghc2.
(The format of our PDB-style files is described here.)

Timeline for d3mghc2: