SCOPe 2.08: Domain d3mghc1: 3mgh C:250-328

Lineage for d3mghc1 (3mgh C:250-328)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)

8. Domain d3mghc1: 3mgh C:250-328 [247697]
   Other proteins in same PDB: d3mgha2, d3mgha3, d3mghc2, d3mghc3
   automated match to d1rzta1
   protein/DNA complex; complexed with na; mutant

Details for d3mghc1

PDB Entry: 3mgh, 2.4 Å

PDB Description: binary complex of a dna polymerase lambda loop mutant

PDB Compounds: (C:) DNA polymerase lambda

SCOPe Domain Sequences for d3mghc1:

Sequence; same for both SEQRES and ATOM records:

>d3mghc1 a.60.6.1 (C:250-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldhi

Timeline for d3mghc1:

• d3mghc1 first appeared in SCOPe 2.04
  
• d3mghc1 appears in SCOPe 2.07