SCOPe 2.07: Domain d3mg4g_: 3mg4 G:

Lineage for d3mg4g_ (3mg4 G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d3mg4g_: 3mg4 G: [247674]
   Other proteins in same PDB: d3mg41_, d3mg42_, d3mg4a_, d3mg4b_, d3mg4c_, d3mg4d_, d3mg4e_, d3mg4f_, d3mg4h_, d3mg4i_, d3mg4j_, d3mg4k_, d3mg4l_, d3mg4m_, d3mg4n_, d3mg4o_, d3mg4p_, d3mg4q_, d3mg4r_, d3mg4s_, d3mg4t_, d3mg4v_, d3mg4w_, d3mg4x_, d3mg4y_, d3mg4z_
   automated match to d1rypa_
   complexed with lxt, mes, mg

Details for d3mg4g_

PDB Entry: 3mg4, 3.11 Å

PDB Description: structure of yeast 20s proteasome with compound 1

PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3mg4g_:

Sequence; same for both SEQRES and ATOM records:

>d3mg4g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

Timeline for d3mg4g_:

• d3mg4g_ first appeared in SCOPe 2.04
  
• d3mg4g_ appears in SCOPe 2.06
  
• d3mg4g_ appears in the current release, SCOPe 2.08