Lineage for d3mdjc4 (3mdj C:615-934)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006934Species Human (Homo sapiens) [TaxId:9606] [189070] (40 PDB entries)
  8. 2006954Domain d3mdjc4: 3mdj C:615-934 [247655]
    Other proteins in same PDB: d3mdja1, d3mdja2, d3mdja3, d3mdjb1, d3mdjb2, d3mdjb3, d3mdjc1, d3mdjc2, d3mdjc3
    automated match to d2yd0a4
    complexed with bes, nag, zn

Details for d3mdjc4

PDB Entry: 3mdj (more details), 2.95 Å

PDB Description: er aminopeptidase, erap1, bound to the zinc aminopeptidase inhibitor, bestatin
PDB Compounds: (C:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3mdjc4:

Sequence, based on SEQRES records: (download)

>d3mdjc4 a.118.1.0 (C:615-934) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsellll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtiet
ieenigwmdknfdkirvwlq

Sequence, based on observed residues (ATOM records): (download)

>d3mdjc4 a.118.1.0 (C:615-934) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsellll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqksssiahmvmgttnqfstrtrleevkcvqqtietieenigwmdknfdkirvw
lq

SCOPe Domain Coordinates for d3mdjc4:

Click to download the PDB-style file with coordinates for d3mdjc4.
(The format of our PDB-style files is described here.)

Timeline for d3mdjc4: