Lineage for d3mdjc2 (3mdj C:255-529)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571488Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2571489Protein automated matches [190805] (18 species)
    not a true protein
  7. 2571522Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)
  8. 2571644Domain d3mdjc2: 3mdj C:255-529 [247653]
    Other proteins in same PDB: d3mdja1, d3mdja3, d3mdja4, d3mdjb1, d3mdjb3, d3mdjb4, d3mdjc1, d3mdjc3, d3mdjc4
    automated match to d2yd0a2
    complexed with bes, bma, man, nag, zn

Details for d3mdjc2

PDB Entry: 3mdj (more details), 2.95 Å

PDB Description: er aminopeptidase, erap1, bound to the zinc aminopeptidase inhibitor, bestatin
PDB Compounds: (C:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3mdjc2:

Sequence, based on SEQRES records: (download)

>d3mdjc2 d.92.1.0 (C:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklditmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicptdgvkgm
dgfcsrsqhssssshwhqervdvktmmntwtlqrg

Sequence, based on observed residues (ATOM records): (download)

>d3mdjc2 d.92.1.0 (C:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklditmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnssddvsydkgacilnmlrey
lsadafksgivqylqkhsykntknedlwdsmasivdvktmmntwtlqrg

SCOPe Domain Coordinates for d3mdjc2:

Click to download the PDB-style file with coordinates for d3mdjc2.
(The format of our PDB-style files is described here.)

Timeline for d3mdjc2: