Lineage for d1e3ja1 (1e3j A:4-150,A:314-351)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165846Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 165974Protein Ketose reductase (sorbitol dehydrogenase) [50145] (1 species)
  7. 165975Species Silverleaf whitefly (Bemisia argentifolii) [TaxId:77855] [50146] (1 PDB entry)
  8. 165976Domain d1e3ja1: 1e3j A:4-150,A:314-351 [24765]
    Other proteins in same PDB: d1e3ja2

Details for d1e3ja1

PDB Entry: 1e3j (more details), 2.3 Å

PDB Description: ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly

SCOP Domain Sequences for d1e3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ja1 b.35.1.2 (A:4-150,A:314-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii)}
dnlsavlykqndlrleqrpipepkedevllqmayvgicgsdvhyyehgriadfivkdpmv
igheasgtvvkvgknvkhlkkgdrvavepgvpcrrcqfckegkynlcpdltfcatppddg
nlaryyvhaadfchklpdnvsleegalXnvkqlvthsfkleqtvdafeaarkkadntikv
miscrq

SCOP Domain Coordinates for d1e3ja1:

Click to download the PDB-style file with coordinates for d1e3ja1.
(The format of our PDB-style files is described here.)

Timeline for d1e3ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ja2