Lineage for d3mdja3 (3mdj A:530-614)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771626Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 1771646Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 1771647Protein automated matches [254707] (3 species)
    not a true protein
  7. 1771648Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries)
  8. 1771653Domain d3mdja3: 3mdj A:530-614 [247646]
    Other proteins in same PDB: d3mdja1, d3mdja2, d3mdja4, d3mdjb1, d3mdjb2, d3mdjb4, d3mdjc1, d3mdjc2, d3mdjc4
    automated match to d2yd0a3
    complexed with bes, nag, zn

Details for d3mdja3

PDB Entry: 3mdj (more details), 2.95 Å

PDB Description: er aminopeptidase, erap1, bound to the zinc aminopeptidase inhibitor, bestatin
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3mdja3:

Sequence, based on SEQRES records: (download)

>d3mdja3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records): (download)

>d3mdja3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkapdtgylwhvpltfitsksdmvhrfllktktdvlilpe
evewikfnvgmngyyivhyed

SCOPe Domain Coordinates for d3mdja3:

Click to download the PDB-style file with coordinates for d3mdja3.
(The format of our PDB-style files is described here.)

Timeline for d3mdja3: