Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
Domain d3mdja1: 3mdj A:46-254 [247644] Other proteins in same PDB: d3mdja2, d3mdja3, d3mdja4, d3mdjb2, d3mdjb3, d3mdjb4, d3mdjc2, d3mdjc3, d3mdjc4 automated match to d2yd0a1 complexed with bes, nag, zn |
PDB Entry: 3mdj (more details), 2.95 Å
SCOPe Domain Sequences for d3mdja1:
Sequence, based on SEQRES records: (download)
>d3mdja1 b.98.1.0 (A:46-254) automated matches {Human (Homo sapiens) [TaxId: 9606]} pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv tvaegliedhfdvtvkmstylvafiisdf
>d3mdja1 b.98.1.0 (A:46-254) automated matches {Human (Homo sapiens) [TaxId: 9606]} pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra tlrkgrlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyr tkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtva egliedhfdvtvkmstylvafiisdf
Timeline for d3mdja1: