Lineage for d3mdja1 (3mdj A:46-254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820686Domain d3mdja1: 3mdj A:46-254 [247644]
    Other proteins in same PDB: d3mdja2, d3mdja3, d3mdja4, d3mdjb2, d3mdjb3, d3mdjb4, d3mdjc2, d3mdjc3, d3mdjc4
    automated match to d2yd0a1
    complexed with bes, nag, zn

Details for d3mdja1

PDB Entry: 3mdj (more details), 2.95 Å

PDB Description: er aminopeptidase, erap1, bound to the zinc aminopeptidase inhibitor, bestatin
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3mdja1:

Sequence, based on SEQRES records: (download)

>d3mdja1 b.98.1.0 (A:46-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
tvaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records): (download)

>d3mdja1 b.98.1.0 (A:46-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
tlrkgrlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyr
tkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtva
egliedhfdvtvkmstylvafiisdf

SCOPe Domain Coordinates for d3mdja1:

Click to download the PDB-style file with coordinates for d3mdja1.
(The format of our PDB-style files is described here.)

Timeline for d3mdja1: