Lineage for d1bxzd1 (1bxz D:1-150,D:315-352)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13455Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 13465Species Thermoanaerobacter brockii [TaxId:29323] [50144] (2 PDB entries)
  8. 13473Domain d1bxzd1: 1bxz D:1-150,D:315-352 [24764]
    Other proteins in same PDB: d1bxza2, d1bxzb2, d1bxzc2, d1bxzd2

Details for d1bxzd1

PDB Entry: 1bxz (more details), 2.99 Å

PDB Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii

SCOP Domain Sequences for d1bxzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxzd1 b.35.1.2 (D:1-150,D:315-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeipleaavmipdXdpsklvthvfrgfdniekafmlmkdkpkd
likpvvila

SCOP Domain Coordinates for d1bxzd1:

Click to download the PDB-style file with coordinates for d1bxzd1.
(The format of our PDB-style files is described here.)

Timeline for d1bxzd1: