![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) |
![]() | Species Thermoanaerobacter brockii [TaxId:29323] [50144] (3 PDB entries) |
![]() | Domain d1bxzd1: 1bxz D:1-139,D:314-352 [24764] Other proteins in same PDB: d1bxza2, d1bxzb2, d1bxzc2, d1bxzd2 complexed with cl, mg, sbt, zn |
PDB Entry: 1bxz (more details), 2.99 Å
SCOPe Domain Sequences for d1bxzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxzd1 b.35.1.2 (D:1-139,D:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]} mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
Timeline for d1bxzd1: