SCOPe 2.08: Domain d3mdba_: 3mdb A:

Lineage for d3mdba_ (3mdb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries)

8. Domain d3mdba_: 3mdb A: [247639]
   automated match to d3fm8a_
   complexed with ip9, unx, zn

Details for d3mdba_

PDB Entry: 3mdb, 2.95 Å

PDB Description: crystal structure of the ternary complex of full length centaurin alpha-1, kif13b fha domain, and ip4

PDB Compounds: (A:) Kinesin-like protein KIF13B

SCOPe Domain Sequences for d3mdba_:

Sequence; same for both SEQRES and ATOM records:

>d3mdba_ b.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsegqvmltp
qkntrtfvngssvsspiqlhhgdrilwgnnhffrlnlp

Timeline for d3mdba_:

• d3mdba_ first appeared in SCOPe 2.04
  
• d3mdba_ appears in SCOPe 2.07