Lineage for d3mcab2 (3mca B:272-379)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201846Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2201981Family d.79.3.0: automated matches [254304] (1 protein)
    not a true family
  6. 2201982Protein automated matches [254705] (2 species)
    not a true protein
  7. 2201983Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255961] (1 PDB entry)
  8. 2201984Domain d3mcab2: 3mca B:272-379 [247638]
    Other proteins in same PDB: d3mcab1
    automated match to d2vgnb3

Details for d3mcab2

PDB Entry: 3mca (more details), 2.74 Å

PDB Description: Structure of the Dom34-Hbs1 Complex and implications for its role in No-Go decay
PDB Compounds: (B:) Protein dom34

SCOPe Domain Sequences for d3mcab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcab2 d.79.3.0 (B:272-379) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vqeirvlnkfydvmneddrkawygpnhvlkafelgaigellisdslfrssdiatrkkwvs
lvegvkeincpvyifsslhesgkqldllsgiaailtypvdeedisede

SCOPe Domain Coordinates for d3mcab2:

Click to download the PDB-style file with coordinates for d3mcab2.
(The format of our PDB-style files is described here.)

Timeline for d3mcab2: