![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.0: automated matches [254304] (1 protein) not a true family |
![]() | Protein automated matches [254705] (2 species) not a true protein |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255961] (1 PDB entry) |
![]() | Domain d3mcab2: 3mca B:272-379 [247638] Other proteins in same PDB: d3mcab1 automated match to d2vgnb3 |
PDB Entry: 3mca (more details), 2.74 Å
SCOPe Domain Sequences for d3mcab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcab2 d.79.3.0 (B:272-379) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} vqeirvlnkfydvmneddrkawygpnhvlkafelgaigellisdslfrssdiatrkkwvs lvegvkeincpvyifsslhesgkqldllsgiaailtypvdeedisede
Timeline for d3mcab2: