SCOPe 2.06: Domain d3mcab1: 3mca B:131-271

Lineage for d3mcab1 (3mca B:131-271)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.0: automated matches [254303] (1 protein)
   not a true family

6. Protein automated matches [254704] (2 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255960] (1 PDB entry)

8. Domain d3mcab1: 3mca B:131-271 [247637]
   Other proteins in same PDB: d3mcab2
   automated match to d2vgna2

Details for d3mcab1

PDB Entry: 3mca, 2.74 Å

PDB Description: Structure of the Dom34-Hbs1 Complex and implications for its role in No-Go decay

PDB Compounds: (B:) Protein dom34

SCOPe Domain Sequences for d3mcab1:

Sequence, based on SEQRES records:

>d3mcab1 c.55.4.0 (B:131-271) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
psrnaeigavvldeglaniclitdymtilrqridqviprkrrgdssayqkgldkfydsvf
qsinsefdfdklkvvilaspgfvarglydyifsmavkldlkqivksknkfvilhsstghi
hslneilkdpaveskladtky

Sequence, based on observed residues (ATOM records):

>d3mcab1 c.55.4.0 (B:131-271) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
psaeigavvldeglaniclitdymtilrqridqviprkrrgdssayqkgldkfydsvfqs
insefdfdklkvvilaspgfvarglydyifsmavkldlkqivksknkfvilhsstghihs
lneilkdpaveskladtky

Timeline for d3mcab1:

• d3mcab1 first appeared in SCOPe 2.04
  
• d3mcab1 appears in SCOPe 2.05
  
• d3mcab1 appears in SCOPe 2.07
  
• d3mcab1 appears in the current release, SCOPe 2.08