![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
![]() | Family c.55.4.0: automated matches [254303] (1 protein) not a true family |
![]() | Protein automated matches [254704] (2 species) not a true protein |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255960] (1 PDB entry) |
![]() | Domain d3mcab1: 3mca B:131-271 [247637] Other proteins in same PDB: d3mcab2 automated match to d2vgna2 |
PDB Entry: 3mca (more details), 2.74 Å
SCOPe Domain Sequences for d3mcab1:
Sequence, based on SEQRES records: (download)
>d3mcab1 c.55.4.0 (B:131-271) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} psrnaeigavvldeglaniclitdymtilrqridqviprkrrgdssayqkgldkfydsvf qsinsefdfdklkvvilaspgfvarglydyifsmavkldlkqivksknkfvilhsstghi hslneilkdpaveskladtky
>d3mcab1 c.55.4.0 (B:131-271) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} psaeigavvldeglaniclitdymtilrqridqviprkrrgdssayqkgldkfydsvfqs insefdfdklkvvilaspgfvarglydyifsmavkldlkqivksknkfvilhsstghihs lneilkdpaveskladtky
Timeline for d3mcab1: