Lineage for d3mbwb_ (3mbw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772521Domain d3mbwb_: 3mbw B: [247636]
    automated match to d1shxa_
    complexed with unx

Details for d3mbwb_

PDB Entry: 3mbw (more details), 2.81 Å

PDB Description: crystal structure of the human ephrin a2 lbd and crd domains in complex with ephrin a1
PDB Compounds: (B:) Ephrin-A1

SCOPe Domain Sequences for d3mbwb_:

Sequence, based on SEQRES records: (download)

>d3mbwb_ b.6.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheeyq
lcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhed
rclrlkvtvs

Sequence, based on observed residues (ATOM records): (download)

>d3mbwb_ b.6.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drhtvfwnssnpkfrnedytihvqlndyvdiicphyevadaameqyilylveheeyqlcq
pqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhedrcl
rlkvtvs

SCOPe Domain Coordinates for d3mbwb_:

Click to download the PDB-style file with coordinates for d3mbwb_.
(The format of our PDB-style files is described here.)

Timeline for d3mbwb_: