Lineage for d3mbqc_ (3mbq C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560843Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1560844Protein automated matches [191182] (11 species)
    not a true protein
  7. 1560959Species Brucella melitensis [TaxId:359391] [255959] (2 PDB entries)
  8. 1560963Domain d3mbqc_: 3mbq C: [247635]
    automated match to d1sixa_
    complexed with edo, gol, so4

Details for d3mbqc_

PDB Entry: 3mbq (more details), 2.1 Å

PDB Description: Crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from Brucella melitensis, orthorhombic crystal form
PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3mbqc_:

Sequence, based on SEQRES records: (download)

>d3mbqc_ b.85.4.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
apviqpkieerakisetargaggf

Sequence, based on observed residues (ATOM records): (download)

>d3mbqc_ b.85.4.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
apviqpkieerakigaggf

SCOPe Domain Coordinates for d3mbqc_:

Click to download the PDB-style file with coordinates for d3mbqc_.
(The format of our PDB-style files is described here.)

Timeline for d3mbqc_: