Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (11 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [255959] (2 PDB entries) |
Domain d3mbqa_: 3mbq A: [247633] automated match to d1sixa_ complexed with edo, gol, so4 |
PDB Entry: 3mbq (more details), 2.1 Å
SCOPe Domain Sequences for d3mbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mbqa_ b.85.4.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]} aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf apviqpkieerakis
Timeline for d3mbqa_: