Lineage for d3maab_ (3maa B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561636Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561637Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2561698Protein automated matches [190310] (3 species)
    not a true protein
  7. 2561702Species Norway rat (Rattus norvegicus) [TaxId:10116] [255957] (2 PDB entries)
  8. 2561703Domain d3maab_: 3maa B: [247629]
    automated match to d1ab8b_
    complexed with ca, cl, fkp, gsp, mg, tat

Details for d3maab_

PDB Entry: 3maa (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5-o-(l-thiophosphate) and low ca concentration
PDB Compounds: (B:) Adenylate cyclase type 2

SCOPe Domain Sequences for d3maab_:

Sequence, based on SEQRES records: (download)

>d3maab_ d.58.29.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d3maab_ d.58.29.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvnt

SCOPe Domain Coordinates for d3maab_:

Click to download the PDB-style file with coordinates for d3maab_.
(The format of our PDB-style files is described here.)

Timeline for d3maab_: