SCOPe 2.05: Domain d3maab_: 3maa B:

Lineage for d3maab_ (3maa B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein automated matches [190310] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255957] (1 PDB entry)

8. Domain d3maab_: 3maa B: [247629]
   automated match to d1ab8b_
   complexed with ca, cl, fkp, gsp, mg, tat

Details for d3maab_

PDB Entry: 3maa, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5-o-(l-thiophosphate) and low ca concentration

PDB Compounds: (B:) Adenylate cyclase type 2

SCOPe Domain Sequences for d3maab_:

Sequence, based on SEQRES records:

>d3maab_ d.58.29.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d3maab_ d.58.29.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvnt

Timeline for d3maab_:

• d3maab_ first appeared in SCOPe 2.04
  
• d3maab_ appears in SCOPe 2.06
  
• d3maab_ appears in the current release, SCOPe 2.08