![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
![]() | Protein automated matches [190310] (3 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [255957] (1 PDB entry) |
![]() | Domain d3maab_: 3maa B: [247629] automated match to d1ab8b_ complexed with ca, cl, fkp, gsp, mg, tat |
PDB Entry: 3maa (more details), 3 Å
SCOPe Domain Sequences for d3maab_:
Sequence, based on SEQRES records: (download)
>d3maab_ d.58.29.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc rgiinvkgkgdlktyfvnt
>d3maab_ d.58.29.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd lktyfvnt
Timeline for d3maab_: