Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein automated matches [190310] (3 species) not a true protein |
Species Canis lupus [TaxId:9615] [255958] (1 PDB entry) |
Domain d3maaa_: 3maa A: [247628] automated match to d1azsa_ complexed with ca, cl, fkp, gsp, mg, tat |
PDB Entry: 3maa (more details), 3 Å
SCOPe Domain Sequences for d3maaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3maaa_ d.58.29.1 (A:) automated matches {Canis lupus [TaxId: 9615]} dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk ehsietflil
Timeline for d3maaa_: