SCOPe 2.04: Domain d3maaa_: 3maa A:

Lineage for d3maaa_ (3maa A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein automated matches [190310] (3 species)
   not a true protein

7. Species Canis lupus [TaxId:9615] [255958] (1 PDB entry)

8. Domain d3maaa_: 3maa A: [247628]
   automated match to d1azsa_
   complexed with ca, cl, fkp, gsp, mg, tat

Details for d3maaa_

PDB Entry: 3maa, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5-o-(l-thiophosphate) and low ca concentration

PDB Compounds: (A:) Adenylate cyclase type 5

SCOPe Domain Sequences for d3maaa_:

Sequence; same for both SEQRES and ATOM records:

>d3maaa_ d.58.29.1 (A:) automated matches {Canis lupus [TaxId: 9615]}
dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri
kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg
vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk
ehsietflil

Timeline for d3maaa_:

• d3maaa_ is new in SCOPe 2.04-stable
  
• d3maaa_ appears in SCOPe 2.05
  
• d3maaa_ appears in the current release, SCOPe 2.08