Lineage for d3maaa_ (3maa A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954780Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2954841Protein automated matches [190310] (3 species)
    not a true protein
  7. 2954842Species Canis lupus [TaxId:9615] [255958] (2 PDB entries)
  8. 2954843Domain d3maaa_: 3maa A: [247628]
    automated match to d1azsa_
    complexed with ca, cl, fkp, gsp, mg, tat

Details for d3maaa_

PDB Entry: 3maa (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5-o-(l-thiophosphate) and low ca concentration
PDB Compounds: (A:) Adenylate cyclase type 5

SCOPe Domain Sequences for d3maaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3maaa_ d.58.29.1 (A:) automated matches {Canis lupus [TaxId: 9615]}
dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri
kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg
vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk
ehsietflil

SCOPe Domain Coordinates for d3maaa_:

Click to download the PDB-style file with coordinates for d3maaa_.
(The format of our PDB-style files is described here.)

Timeline for d3maaa_: