Lineage for d3m85h2 (3m85 H:179-258)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663436Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1663498Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1663499Species Archaeoglobus fulgidus [TaxId:2234] [160598] (4 PDB entries)
    Uniprot O29756 179-257
  8. 1663510Domain d3m85h2: 3m85 H:179-258 [247625]
    Other proteins in same PDB: d3m85d1, d3m85d2, d3m85e1, d3m85e2, d3m85f1, d3m85f2, d3m85g1, d3m85h1, d3m85i1
    automated match to d3m7nh2
    protein/RNA complex; complexed with zn

Details for d3m85h2

PDB Entry: 3m85 (more details), 3 Å

PDB Description: Archaeoglobus fulgidus exosome y70a with RNA bound to the active site
PDB Compounds: (H:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3m85h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m85h2 d.101.1.1 (H:179-258) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
pvrdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklf
delldvsincarklrekfke

SCOPe Domain Coordinates for d3m85h2:

Click to download the PDB-style file with coordinates for d3m85h2.
(The format of our PDB-style files is described here.)

Timeline for d3m85h2: