Lineage for d1bxzb1 (1bxz B:1-139,B:314-352)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558338Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 558352Species Thermoanaerobacter brockii [TaxId:29323] [50144] (2 PDB entries)
  8. 558354Domain d1bxzb1: 1bxz B:1-139,B:314-352 [24762]
    Other proteins in same PDB: d1bxza2, d1bxzb2, d1bxzc2, d1bxzd2

Details for d1bxzb1

PDB Entry: 1bxz (more details), 2.99 Å

PDB Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii

SCOP Domain Sequences for d1bxzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxzb1 b.35.1.2 (B:1-139,B:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila

SCOP Domain Coordinates for d1bxzb1:

Click to download the PDB-style file with coordinates for d1bxzb1.
(The format of our PDB-style files is described here.)

Timeline for d1bxzb1: