Lineage for d3m85e1 (3m85 E:6-153)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636876Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1637019Protein automated matches [232811] (2 species)
    not a true protein
  7. 1637020Species Archaeoglobus fulgidus [TaxId:2234] [232894] (2 PDB entries)
  8. 1637025Domain d3m85e1: 3m85 E:6-153 [247618]
    Other proteins in same PDB: d3m85d2, d3m85e2, d3m85f2, d3m85g1, d3m85g2, d3m85h1, d3m85h2, d3m85i1, d3m85i2
    automated match to d2ba1d1
    protein/RNA complex; complexed with zn

Details for d3m85e1

PDB Entry: 3m85 (more details), 3 Å

PDB Description: archaeoglobus fulgidus exosome y70a with rna bound to the active site
PDB Compounds: (E:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d3m85e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m85e1 d.14.1.4 (E:6-153) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
ekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhpe
hlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidi
fvevlqadagsrtaclnaasvalvdagv

SCOPe Domain Coordinates for d3m85e1:

Click to download the PDB-style file with coordinates for d3m85e1.
(The format of our PDB-style files is described here.)

Timeline for d3m85e1: