Lineage for d3m85d2 (3m85 D:154-250)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967486Protein automated matches [232896] (1 species)
    not a true protein
  7. 2967487Species Archaeoglobus fulgidus [TaxId:2234] [232897] (2 PDB entries)
  8. 2967491Domain d3m85d2: 3m85 D:154-250 [247617]
    Other proteins in same PDB: d3m85d1, d3m85e1, d3m85f1, d3m85g1, d3m85g2, d3m85h1, d3m85h2, d3m85i1, d3m85i2
    automated match to d2ba1d2
    protein/RNA complex; complexed with zn

Details for d3m85d2

PDB Entry: 3m85 (more details), 3 Å

PDB Description: archaeoglobus fulgidus exosome y70a with rna bound to the active site
PDB Compounds: (D:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d3m85d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m85d2 d.101.1.1 (D:154-250) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pmkgmitsvavgkadgqlvldpmkeednfgeadmpfaflirngkiesiallqmdgrmtrd
evkqaielakkgalqiyemqreailrryievgeemde

SCOPe Domain Coordinates for d3m85d2:

Click to download the PDB-style file with coordinates for d3m85d2.
(The format of our PDB-style files is described here.)

Timeline for d3m85d2: