Lineage for d3m5if_ (3m5i F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2591818Domain d3m5if_: 3m5i F: [247615]
    Other proteins in same PDB: d3m5ia_, d3m5ic_, d3m5ie_
    automated match to d4n5zb_
    complexed with nag

Details for d3m5if_

PDB Entry: 3m5i (more details), 3 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin complexed with 6sln
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d3m5if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5if_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn
qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye
rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnri

SCOPe Domain Coordinates for d3m5if_:

Click to download the PDB-style file with coordinates for d3m5if_.
(The format of our PDB-style files is described here.)

Timeline for d3m5if_: